PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s942951g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MIKC_MADS
Protein Properties Length: 234aa    MW: 27236.9 Da    PI: 9.528
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s942951g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.84.6e-31958150
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                       krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+
  PDK_30s942951g001  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYA 58
                       79***********************************************8 PP

2K-box110.12.4e-36771734100
              K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                        s++ s++ea+ +++qqe++kL+++i nLq+++R+l+Ge+L+s++l++L+qLe +Lek+++kiR+kKnelll++ie++qk+e elq++n++Lr
  PDK_30s942951g001  77 SNSGSVSEANFQYYQQESSKLRQQITNLQNSNRNLMGESLGSMNLRDLKQLEGRLEKGINKIRTKKNELLLAEIEYMQKRELELQSANMYLR 168
                        444559************************************************************************************** PP

              K-box  96 kklee 100
                        +k+ e
  PDK_30s942951g001 169 NKITE 173
                        **976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.852161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.24E-33274IPR002100Transcription factor, MADS-box
CDDcd002651.92E-44271No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-32323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-323859IPR002100Transcription factor, MADS-box
PfamPF014862.3E-2787171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.44587177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALVIFST RGRLYEYAND  60
SVKGTIERYK KACTDTSNSG SVSEANFQYY QQESSKLRQQ ITNLQNSNRN LMGESLGSMN  120
LRDLKQLEGR LEKGINKIRT KKNELLLAEI EYMQKRELEL QSANMYLRNK ITENERAQQQ  180
MNMLTPTTEY EVMPPYDSRN FLPMNLMQSN QHYSHQQQTA LQLGYQLALD HQIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-20169169Myocyte-specific enhancer factor 2B
1tqe_R1e-20169169Myocyte-specific enhancer factor 2B
1tqe_Q1e-20169169Myocyte-specific enhancer factor 2B
1tqe_P1e-20169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00093SELEXTransfer from AT3G58780Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7396990.0AY739699.1 Elaeis guineensis MADS box transcription factor (AG2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008794140.11e-165PREDICTED: floral homeotic protein AGAMOUS-like isoform X2
SwissprotQ408721e-122AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLQ2NNC21e-149Q2NNC2_ELAGV; MADS box transcription factor
STRINGGSMUA_Achr10P21480_0011e-130(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.11e-113MIKC_MADS family protein